Every lot is tried & tested in a relevant biological assay. Our Bioassay
Origin Synthetic peptide
MW: 4230.9 Da
Purity: >98% (HPLC)
Effective concentration 50-100 nM.
Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ.
Modifications Disulfide bonds between: Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid.
Structure
Molecular formula C179H276N50O56S7.
CAS No.: 129203-60-7
Activity Iberiotoxin is a potent selective blocker of the high conductance Ca2+-activated K+ channels (maxi-K).
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
A. Time course of KCa1.1 channel current amplitude before (black), during (green, marked by horizontal bar) application of 100 nM Iberiotoxin (#STI-400) for 200 sec and upon wash of the toxin. Currents were elicited every 10 sec by ramp stimulation to +100 mV from a holding of –100 mV for 100 msec. B. Superimposed example current responses before (black) and during (green) application of 100 nM Iberiotoxin (taken from the experiment in A).
References - Scientific background
Galvez, A.et al. (1990) J. Biol. Chem. 265, 11083.
Meera, P.et al. (2000) Proc. Natl. Acad. Sci. U.S.A.97, 5562.
Scientific background Iberiotoxin is a 37 amino acid peptidyl toxin isolated from the scorpion Mesobuthus tamulus and was shown to block large conductance Ca2+-activated K+ channels in smooth muscle cells1. Later it was shown to specifically block KCa1.1 (Slo) channels with Ki of about 1 nM2. In addition, experiments with cloned KCa1.1 channels demonstrate the strong effect of the sloβ subunits on the potency of block by Iberiotoxin3.
Image & Title Alomone Labs Iberiotoxin blocks BKCa channels in human chorionic plate arterial smooth muscle cells.Inhibition of BKCa channels with Iberiotoxin (#STI-400) which abolished outward currents at +80 mV by 61 ± 12%. Cells were voltage clamped at -60 mV and step depolarised from -70 mV to +80 mV for 500 ms in 10 mV increments and repolarised to -40 mV.Adapted from Brereton, M.F.et al. (2013) PLoS ONE8, e57451. with permission of PLoS.
Last update: 25/04/2021
Iberiotoxin (#STI-400) is a highly pure, synthetic, and biologically active peptide toxin.
Blocking BK channels mimics the mAChR activation effects.
A. and B. uEPSC (left), uEPSP (middle), and ΔGuEPSP/Gsat (right) measured in the presence of Apamin (#STA-200) (A) and Iberiotoxin (#STI-400) (B). The range of amplitudes ±SEM of the uEPSP and ΔGuEPSP/Gsat measured in control conditions are shown by the gray shaded bars. C. Summary of the uEPSC amplitude, uEPSP amplitude, uEPSP decay time constant, and ΔGuEPSP/Gsat in each pharmacological condition. Adapted from He, S.et al. (2014) with permission of the Society for Neuroscience.
Bioassay Tested
Alomone Labs Iberiotoxin inhibits KCa1.1 channels (mSlo) heterologously expressed in Xenopus oocytes.A. Time course of KCa1.1 channel current amplitude before (black), during (green, marked by horizontal bar) application of 100 nM Iberiotoxin (#STI-400) for 200 sec and upon wash of the toxin. Currents were elicited every 10 sec by ramp stimulation to +100 mV from a holding of –100 mV for 100 msec. B. Superimposed example current responses before (black) and during (green) application of 100 nM Iberiotoxin (taken from the experiment in A).
Blocking BK channels mimics the mAChR activation effects.A. and B. uEPSC (left), uEPSP (middle), and ΔGuEPSP/Gsat (right) measured in the presence of Apamin (#STA-200) (A) and Iberiotoxin (#STI-400) (B). The range of amplitudes ±SEM of the uEPSP and ΔGuEPSP/Gsat measured in control conditions are shown by the gray shaded bars. C. Summary of the uEPSC amplitude, uEPSP amplitude, uEPSP decay time constant, and ΔGuEPSP/Gsat in each pharmacological condition.