Free shipping starts now, no minimum, no coupons required!

Jingzhaotoxin-34

Mu-theraphotoxin-Cg1a, Mu-TRTX-Cg1a, JZTX-34, Peptide F6-25.51

A Selective Blocker of NaV1.7 Channels and Weak Blocker of Nav1.3

Cat #: STJ-500
Alternative Name Mu-theraphotoxin-Cg1a, Mu-TRTX-Cg1a, JZTX-34, Peptide F6-25.51
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
    Source Synthetic peptide
    MW: 4150.7 Da
    Purity: >98% (HPLC)
    Form Lyophilized Powder
    Effective concentration 0.5 µM
    Sequence ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV-OH
    Modifications Disulfide bonds location - Cys2-16, Cys9-21 and Cys15-29
    Structure
    Molecular formula C182H258N52O49S6
    Activity Potent and selective inhibitor of hNav1.7 and weak blocker of Nav1.3. JZTX-34 shows analgesic activity in rodent pain models1. In addition, this toxin inhibits voltage-gated potassium channels (Kv) in rat DRG neurons1.
    References-Activity
    1. Zeng, X. et al. (2018) Toxins, 10, 64.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.
    Solubility Centrifuge all products before use (10000 x, g 5 min). Soluble in water. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles.
    Storage of solutions Store up to one week at 4°C or up to 6 months at -20°C
    Our bioassay
    • Alomone Labs Jingzhaotoxin-34 inhibits NaV1.7 channel currents heterologously expressed in Xenopus oocytes.
      Alomone Labs Jingzhaotoxin-34 inhibits NaV1.7 channel currents heterologously expressed in Xenopus oocytes.
      A. Representative time course of Jingzhaotoxin-34 (#STJ-500) inhibition of NaV1.7 channels current. Membrane potential was held at -80 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec, and significantly inhibited by application of 0.5 µM Jingzhaotoxin-34 (green).
      B. Superimposed traces of NaV1.7 channel currents in the absence (control) and presence (green) of 0.5 µM Jingzhaotoxin-34 (taken from the recording in A).
    References - Scientific background
    1. Chen, J. et al. (2008) Cell. Mol. Life Sci., 65, 2431.
    2. Chen J. et al. (2009) Peptides, 30, 1042.
    3. Zeng, X. et al. (2018) Toxins, 10, 64.
    4. Laedermann, C.J. et al. (2015) Front. Pharmacol., 6, 263.
    Scientific background

    Jingzhaotoxin-34 (JZTX-34) is a 35 amino acid peptidyl toxin originally isolated from the venom of the Chinese earth tiger tarantula, Chilobrachys guangxiensis1,2. JZTX-34 is a potent and selective blocker of the voltage-gated sodium (NaV) 1.7 channel and a weak blocker of the Nav1.3 channel. In addition, this toxin inhibited voltage-gated potassium (Kv) channels in rat DRG neurons3.

    Nav channels are transmembrane proteins that control the voltage-dependent increase in sodium permeability. They play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. Nav channels are composed of nine different isoforms with distinct biophysical properties. Several studies, including the analysis of mutations associated with an increase or absence of pain sensitivity in humans, have revealed that Nav1.7, Nav1.8, and Nav1.9 are the most important contributors that control nociceptive neuronal electrogenesis4. JZTX-34 exhibited analgesic activity in three rodent pain models3.

    Target Nav1.7
    Peptide Content: 100%
    Last update: 29/08/2021

    Jingzhaotoxin-34 (#STJ-500) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information